SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002053 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002053
Domain Number 1 Region: 72-165
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000000543
Family Phosphate binding protein-like 0.00000145
Further Details:      
 
Domain Number 2 Region: 7-67
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000848
Family L-arabinose binding protein-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002053   Gene: ENSOARG00000001953   Transcript: ENSOART00000002102
Sequence length 226
Comment pep:novel scaffold:Oar_v3.1:JH922196.1:26380:30691:1 gene:ENSOARG00000001953 transcript:ENSOART00000002102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGE
TEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPG
SPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVGVVPRSRRRTGACSL
EGLRRAGPEPGRSLEWVTHEMGRGGSLSGEWGPRCPRPHRRVAPQG
Download sequence
Identical sequences W5NV58
ENSOARP00000002053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]