SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002343 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002343
Domain Number 1 Region: 173-317
Classification Level Classification E-value
Superfamily TPR-like 4.4e-22
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 6-93,131-157
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000114
Family FKBP immunophilin/proline isomerase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002343   Gene: ENSOARG00000002219   Transcript: ENSOART00000002394
Sequence length 328
Comment pep:known_by_projection chromosome:Oar_v3.1:11:25047636:25060312:1 gene:ENSOARG00000002219 transcript:ENSOART00000002394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDATLLLNVEGIKKTILHGGTGDLPNFITGARVTFHFRTMKCDEERTVIDDSKQVGHPMH
IIIGNMFKLEVWEILLTSMRVSEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLIFIIELLQVEAPSQYQRETWNLNNHEKMQAVPI
LHGEGNRLFKLGRYEEASNKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKA
VQRELRLLENRLEEKREEERLRCRNMLG
Download sequence
Identical sequences W5NVZ7
ENSOARP00000002343 XP_004012634.1.66739 XP_012002347.1.54773 XP_017919535.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]