SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002375 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002375
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily dUTPase-like 2.62e-17
Family dUTPase-like 0.001
Further Details:      
 
Domain Number 2 Region: 119-196
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000285
Family Retroviral protease (retropepsin) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002375   Gene: ENSOARG00000002244   Transcript: ENSOART00000002426
Sequence length 196
Comment pep:novel scaffold:Oar_v3.1:JH922721.1:1553:2176:1 gene:ENSOARG00000002244 transcript:ENSOART00000002426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSVAIDIPALNDFSLYPQAAPSRVPTGLFGPQPLQTFGLSLGKSSLTSKGITVHPGVID
SDYKGDIQMMMSSQILWQFKKGDKIAQLLLSPYIFINSSNNIKNNPYGHHWYFNIPDQIN
IKINGTRFSGLLNTGSDITIISRHLWPKTWPIQKNLLRNCSKVQEIYQNIQIYPYEGPKG
QPTTLRPYVIDAPLNL
Download sequence
Identical sequences W5NW28
ENSOARP00000002375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]