SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002427 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002427
Domain Number 1 Region: 328-502,536-700
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-79
Family YicI catalytic domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 92-326
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.16e-39
Family YicI N-terminal domain-like 0.0062
Further Details:      
 
Domain Number 3 Region: 703-797
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-16
Family Putative glucosidase YicI, domain 3 0.0049
Further Details:      
 
Domain Number 4 Region: 67-105
Classification Level Classification E-value
Superfamily Trefoil 0.00000000114
Family Trefoil 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002427   Gene: ENSOARG00000002285   Transcript: ENSOART00000002479
Sequence length 930
Comment pep:known_by_projection chromosome:Oar_v3.1:11:51482992:51494908:-1 gene:ENSOARG00000002285 transcript:ENSOART00000002479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMMRWPPCSRTLLGVCTLLSLALLGHILLHDLEMVPRELRGFSQDEIHQACQPGASSPDC
RGSPRAAPTQCDLPPNSRFDCAPDKGITQQQCEARGCCYVPAEWPPDAPLGYPSYRLENL
TSTETGYTATLTRAVPTFFPKDIMTLKLDVLMETESRLHFTIKDPANRRYEVPLETPRVS
SQAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSHYITGLA
EHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLLNSNAMDVV
LQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGRPHPSPGCSLPNPSCPLTVYST
SAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQGGRRYIM
IVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGGVWPGLTAFPDFTNPEALDWWQ
DMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLRAATICAS
SHQFLSTHYDLHNLYGLTEALASHRALVKARGTRPFVISRSTFAGHGRYSGHWTGDVWSN
WEQLSYSVPETLLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNALISQ
PQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFPEDPSTWTV
DRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAIGSLPPPAPLTSVIHSKG
QWVTLSAPLDTINVHLRAGYIIPMQGPALTTTESRKQPMALAVALTASGEAQGELFWDDG
ESLGVLDGGDYTQLIFLAKNNTFVNKLVHMSSEGASLQLRNVTVLGVATAPQQVLCNSVP
VSNFTFNPDTETLAIPVSLTMGEQFVISWS
Download sequence
Identical sequences W5NW80
ENSOARP00000002427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]