SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002681 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002681
Domain Number 1 Region: 283-465,583-629
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.25e-28
Family Reverse transcriptase 0.0043
Further Details:      
 
Domain Number 2 Region: 743-875
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.04e-26
Family Retroviral integrase, catalytic domain 0.00066
Further Details:      
 
Domain Number 3 Region: 10-131
Classification Level Classification E-value
Superfamily dUTPase-like 1.3e-24
Family dUTPase-like 0.00038
Further Details:      
 
Domain Number 4 Region: 137-267
Classification Level Classification E-value
Superfamily Acid proteases 1.44e-21
Family Retroviral protease (retropepsin) 0.00064
Further Details:      
 
Domain Number 5 Region: 881-928
Classification Level Classification E-value
Superfamily DNA-binding domain of retroviral integrase 0.0000000000000445
Family DNA-binding domain of retroviral integrase 0.0032
Further Details:      
 
Domain Number 6 Region: 686-733
Classification Level Classification E-value
Superfamily N-terminal Zn binding domain of HIV integrase 0.000000000549
Family N-terminal Zn binding domain of HIV integrase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002681   Gene: ENSOARG00000002521   Transcript: ENSOART00000002734
Sequence length 939
Comment pep:novel chromosome:Oar_v3.1:X:133140743:133143922:1 gene:ENSOARG00000002521 transcript:ENSOART00000002734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLYSLCSILELLRATPGSTGLDLSSATATILTPGISVTPIPTGVAGPLPEGIVGLVLGY
SSLSLQGISVVPGVVNSDYTHEIKVLILPPPKTVQINKGERIAQLLLLPYYQTRKTLTSQ
ARGPRVFGSSDLALGVQEITASRPLKDLLIQRNKMSGLLDIGADVSCIAGKKLALVLVDT
NAGLVGIASVPSVAKSSQILTWSDEKGAQGTFCPYVIPSLPFSLWGRDILSQMGMILYSP
DEKVANQKYNPDKGLGKDQQGIASPLGVIPNTNKEVLGFKFIQNSPTLCQKFVDQAVQNY
KDLYLIHYMDDILAAHKDRALLQQILKIAPDKIQVNPPFSYLGRILNTHTVSHAPLQLHR
DHLLILNDFIQKLTVLINWIHPHLKLTTADLKPLFDCLKGDPNPSSKRELTSEAESALVK
VDEALNDQLIRVNITRGWDLIILTTEHTPTGCLWQEGPLEWLHLPVTPRKIVLSYPSLVE
QLIIKGRKRSMELFGMEVANIVIPFNNDQLQFLLQNSDDWQLALIDFRGQILFHLPSSPL
LHFLKTHPVIFLNFSPIQPLEGAILVFTDSSYHGKAVTIIDGKSQVQVTEETSAQKAELR
EVIWTFQHLRDGTFNLLTDSQYIVGLFPHIETANIPENFSLLSDLQEEIKHRDKKYFVGH
IRAHSSLPSPLNEGNGLADALSKSYMKAKNSHKIHHQNAAGLRYEFHFPREAARQIVCPN
CPTFNPSPQLGVNPRGLRPNALSQMGITHIPAFGKLSFVHVTVDNFSHVIIASARSGEAA
RDVIQHLFQCFSQIGLPEQIKTDNTPAYPSAAFKRILHSTGIPYNPQGQAIVERVHQNLK
KSSSPHHVLHHALFVINHLNVDTQGQTAMTRHWTPEGAMTQPLVKQKDLLTGEWRGLDVL
LTCGRGYACVFPQDSTSPAWIPDRLIWHVQSHETSRITK
Download sequence
Identical sequences W5NWY4
ENSOARP00000002681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]