SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002718 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002718
Domain Number 1 Region: 110-166
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000523
Family Ribosomal protein L11, C-terminal domain 0.0063
Further Details:      
 
Domain Number 2 Region: 24-100
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000000000124
Family Ribosomal L11/L12e N-terminal domain 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002718   Gene: ENSOARG00000002558   Transcript: ENSOART00000002772
Sequence length 183
Comment pep:novel chromosome:Oar_v3.1:24:38398774:38399340:1 gene:ENSOARG00000002558 transcript:ENSOART00000002772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLEEAKSCFLGSSEIHVVLTPSASTMPPKFNTNKIRVYNEVHRGEVGTMSALAPKTGPG
LSAKEAGDDITKATGDWKGLRTVKLIIQSRQAQIEWYRTSEALKELPRDRKKQKNTRYSG
NIGFNEMVTIARQMHHRSLARKLSGTIKEILGIAQSVGCNVDGCHPHDIIDDINSGAVEC
SQL
Download sequence
Identical sequences W5NX21
ENSOARP00000002718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]