SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002810 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002810
Domain Number 1 Region: 96-203
Classification Level Classification E-value
Superfamily Acid proteases 6.33e-18
Family Retroviral protease (retropepsin) 0.001
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily dUTPase-like 0.0000000291
Family dUTPase-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002810   Gene: ENSOARG00000002648   Transcript: ENSOART00000002865
Sequence length 203
Comment pep:novel scaffold:Oar_v3.1:JH921806.1:56201:57612:1 gene:ENSOARG00000002648 transcript:ENSOART00000002865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSSTTVTILTPDVPVTQIPMGVADPLPEGIVLLLLRCSLLSFQGILVVSGVVDSDYTEK
KALVSPPTETTQINKDLRITQLTRKTLTSQARGPRRFGSSDLAFVQGTTACRPLKYLLIQ
GYKMSGLLDTRTDVSCIAGKDWPSSWPTHTTENELVGLEPTSDPKKNSFILSELGSTINF
KIYVVPSITFTLWGRDVLSQIGV
Download sequence
Identical sequences W5NXB3
ENSOARP00000002810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]