SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003103 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003103
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000288
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000003103
Domain Number - Region: 279-325
Classification Level Classification E-value
Superfamily ARM repeat 0.00253
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003103   Gene: ENSOARG00000002918   Transcript: ENSOART00000003163
Sequence length 376
Comment pep:known chromosome:Oar_v3.1:7:89482053:89517062:-1 gene:ENSOARG00000002918 transcript:ENSOART00000003163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQAQQVLIPASQQAAAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
Download sequence
Identical sequences W5NY55
ENSOARP00000003103 XP_004010876.1.66739 XP_005212289.1.76553 XP_005894326.1.15283 XP_010849180.1.44457 XP_012011277.1.54773 XP_017909383.1.57651 XP_020740766.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]