SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003190 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003190
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000392
Family TNF receptor-like 0.007
Further Details:      
 
Domain Number 2 Region: 61-108
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000265
Family TNF receptor-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003190   Gene: ENSOARG00000003000   Transcript: ENSOART00000003250
Sequence length 131
Comment pep:novel scaffold:Oar_v3.1:JH923069.1:18584:22834:1 gene:ENSOARG00000003000 transcript:ENSOART00000003250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEKTFCNPGEYEVLGNDSCSRVCPPGYYVSTRIDQDHHIGACSPCPSGTFRAHPSEEP
RCVPCAQCREDQEVVKLCSTTSDQECQCQPGQFYCDSEDCTESCFRCTRCHPACEDGATL
QPCTATSNAIC
Download sequence
Identical sequences W5NYE2
ENSOARP00000003190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]