SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003245 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003245
Domain Number 1 Region: 725-816
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000135
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 11-55
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000608
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003245   Gene: ENSOARG00000003051   Transcript: ENSOART00000003306
Sequence length 856
Comment pep:known_by_projection chromosome:Oar_v3.1:3:154424914:154498447:-1 gene:ENSOARG00000003051 transcript:ENSOART00000003306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RENGGASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQQHRSGGR
GTKTRNSNNNNTADATVAAAGPAAAAVGMGVRPVSGDLSYLRTPGGLGRVSASGPETPLG
GPGGASATLTAGSKVLLGFSSDEGGPGRPAAPGLQSPSGGDGAADDEEQEGEDGESRARG
PGEPLWSGRTVNGSRLLPYSCRENYSDSEEEEDDDVASSRQVLKDDTLSRHRPRRGHSKP
LSPLPAKSAVGRLETSVQGGGGIAMNDRAAAAGSLDRSRNLEESAAAAEQGGGCDSLDSS
PIPRYRVNTKKLTPLLPPPLADMDSTLDSSTGSLLKTNNHIGGGAFGVDSPRISLPPSAA
VAASSSLRINHSNHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGGFSAHYLSM
FLLTAACLFFLILGLTYLGMRGTGVSEDGGLGIKNPFDETFGNIQESEKNLMMNTLYKLH
DRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEDIFNISLQWIFENGKDVGIRCVG
YGPEEELTDIVDVQFLQSTRPQMSFWCRFRRAFVTVTHRLLLLCLGVVMVCAVLRYMKYR
WTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKV
WDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRR
NSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVY
VKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCNTPLKPSNKHMNSM
SHLRLRTGLANSQGGS
Download sequence
Identical sequences W5NYJ7
ENSOARP00000003245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]