SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003338 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003338
Domain Number 1 Region: 301-564
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.26e-86
Family Eukaryotic proteases 0.00000000186
Further Details:      
 
Domain Number 2 Region: 106-210
Classification Level Classification E-value
Superfamily Kringle-like 1.5e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 216-302
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-30
Family Kringle modules 0.0000409
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 8.16e-19
Family Fibronectin type I module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003338   Gene: ENSOARG00000003130   Transcript: ENSOART00000003401
Sequence length 565
Comment pep:known_by_projection chromosome:Oar_v3.1:26:35536329:35547219:-1 gene:ENSOARG00000003130 transcript:ENSOART00000003401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNAMKTQFLCLLLCGAVFTWPSQETYRRLRRGARSYRVTCRDEKTQMTYLQHESWLRPL
LRGNQVEHCRCNGGRAQCHSVPVRSCSEPWCFNGGTCQQALYSSDFVCQCPEGFMGKLCE
IDATATCYKDQGVAYRGTWSTAESGAECASWNSSGLAMKPYSGRRPDAVRLGLGNHNYCR
NPDQDSKPWCYVFKAGKYISEFCSTPACTKVAEEDGDCYTGNGLAYRGTRSRTKSGFSCL
PWNSVFLTSKIYTAWKSNARALGLGKHNHCRNPDGDAQPWCHVWKDRQLTWEYCDVPQCV
TCGLRQYKRPQFRIKGGLFADITSHPWQAAIFVKNRRSPGQRFLCGGILISSCWVLSAAH
CFQERYPPHHLKVILGRTYRLVPGEEEQMFEVEKYIVHKEFDDDTYDNDIALLHLKSNSL
TCAQESGSVRTICLPDASLQLPDWTECELSGYGKHEASSPFFSERLKEAHVRLYPSSRCT
SRHLFNRTVTNNMLCAGDTRSGGDHTNLHDACQGDSGGPLVCMKDNHMTLVGIISWGLGC
GQKDIPGVYTKVTNYLDWIRDNMRL
Download sequence
Identical sequences W5NYU0
ENSOARP00000003338 XP_011961401.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]