SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003353 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003353
Domain Number 1 Region: 962-1163
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000458
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000003353
Domain Number - Region: 490-543
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003353   Gene: ENSOARG00000003144   Transcript: ENSOART00000003417
Sequence length 1325
Comment pep:known_by_projection chromosome:Oar_v3.1:11:35178762:35336451:1 gene:ENSOARG00000003144 transcript:ENSOART00000003417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRGKEGAWSQEIPLSQXSVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QISGSDQLESTAHSRIRKERPISLGIFPLPSGDGLLTPDTQKGGETPGSEQWKFQELSQP
RSHTSLKDELSDVSQGGSKATTPASTAASDVAVIPSDTPLHEENEGIVKAADTPDTSERS
KHIEVQVVQETRNIPTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKA
FDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNVVKNDL
IAKVDELTCEKDVLQGELEAVKQAKLKLEEKNKELEEELRKARAEVEDAKQKAKDDDDSD
IPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQ
FFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSRAFDFLSEET
EASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQITNGQGENKMKNLPVPVY
LRPLDEKDTSMKPTKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLEAEGSKQRSASQ
NSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVIIIDAVQPGNILDSFTVCNSH
VLCISSVPGARETDYPAGEELSESGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEG
ITAAATSPNTNETSPVMEKPPEKETENSEIDENVPTAEEATEATEGNAGSAEDTVDVSQT
GVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPT
MWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDG
QWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ
VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITAL
MVSCNRLWVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGASGNRPGSVIRVYGDENS
DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPEIGQVISPQSGSSGTDLTVDKAGPS
AQEPGIQTPLKSVLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVAKAERSHLIVWQV
MCGSE
Download sequence
Identical sequences W5NYV5
ENSOARP00000003353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]