SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003760 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003760
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily AlbA-like 5.49e-19
Family DNA-binding protein AlbA 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003760   Gene: ENSOARG00000003526   Transcript: ENSOART00000003827
Sequence length 160
Comment pep:known_by_projection chromosome:Oar_v3.1:2:36737672:36738154:1 gene:ENSOARG00000003526 transcript:ENSOART00000003827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRAGSKIRNLLGLALERLEGGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLYQLTKLRFLQTEDSWVPTSPDTGLDPLTVRSHVPAVWVL
LSRDPLDPNEYGYQPPGAPPPTPASSCGPQPRRRARDTRF
Download sequence
Identical sequences W5P012
ENSOARP00000003760 XP_004004174.1.66739 XP_011973354.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]