SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003764 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003764
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.96e-36
Family Ribosomal protein L20 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003764   Gene: ENSOARG00000003529   Transcript: ENSOART00000003831
Sequence length 149
Comment pep:known_by_projection chromosome:Oar_v3.1:12:49201530:49204199:1 gene:ENSOARG00000003529 transcript:ENSOART00000003831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLSAPLWLRNRITDRYWRVQEVLKHARHFQGRKNRCYRLAVRAVTRAFVRCTRARSLK
KRNLRTLWINRITAASQEHGLKYPAFILNLIKCQVELNRKVLADLAIYEPKTFKSLAALS
KRRREEGFVAALGDGKEPEGIFSRVAQHH
Download sequence
Identical sequences W5P016
XP_004013829.1.66739 XP_005966310.1.78601 XP_011993896.1.54773 XP_017916014.1.57651 ENSOARP00000003764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]