SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003794 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003794
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 2.81e-43
Family Nip7p homolog, N-terminal domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 7.18e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003794   Gene: ENSOARG00000003558   Transcript: ENSOART00000003861
Sequence length 180
Comment pep:known_by_projection chromosome:Oar_v3.1:14:35822283:35824107:1 gene:ENSOARG00000003558 transcript:ENSOART00000003861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHKDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences W5P046
XP_004015147.1.66739 XP_005692242.1.57651 XP_011966045.1.54773 ENSOARP00000003794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]