SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003840 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003840
Domain Number 1 Region: 2-568
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.89e-81
Family Acetyl-CoA synthetase-like 0.0000454
Further Details:      
 
Domain Number 2 Region: 749-1103
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0077
Further Details:      
 
Domain Number 3 Region: 553-630
Classification Level Classification E-value
Superfamily ACP-like 0.0000072
Family Peptidyl carrier domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003840   Gene: ENSOARG00000003597   Transcript: ENSOART00000003908
Sequence length 1107
Comment pep:known_by_projection chromosome:Oar_v3.1:6:71762894:71788566:-1 gene:ENSOARG00000003597 transcript:ENSOART00000003908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQAASLYSDKIAVCFDECNNQPPVYYTYKTVINAASALSNFLLLHCDFQGIRE
IGLYCHPTINLPSWVLGILQVPAAYAPVDPDSPPALSIHFMKKCNLKYILVEKVHISKFK
SSYEALLNYDMLTVEHNDLVLFRLHWKNVEVSLVPNDRKEKYEKGTMTKSMPSESSSEEK
SEEHMDVKLKHCLAYVLHTSGTTGIPKIVRVPHACIVPNIQHFRVLFEITHEDVLFLASP
LTFDPSVVEIFVALSSGASLLIVPTSVKMVPSKLAAVLFSHHRVTILQATPTLLRRFGSQ
LIKSTVLSTNTSLRILALGGEAFPSLTVLKSWRGVGNKTQIFNLYGITEVSSWATFYRIP
EKILNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGNGQVFLGGRNRVCFLDGEMTVP
LGTMRATGDFVTIKDGEIFFLGRKDSQIKRHGKRLNIELVQQIAEGLQQVESCAVTWYNQ
EKLILFMVTKNDLVKDYIFEELQKHLPSHAIPDELVLINSLPFTSHGKIDVSELNKIYLN
YRDLKSECKLSGKEELWEKLHHLWKSVLSLSEDALKIPDESLFLNSGGDSLKSIRLLNEI
ENLVGTSVPGLLEILLSSSILEIYNHILQTVFSDKDLTVSKNHAMKRKFSDATQEEASGK
SLHQEAVVPLNCDNESNAFIALSRGSQILSLNTDRYLTKLGHCPSTYSSDLNSQTDIQNR
ESLSTPPLVGKSEDPSCVVEVSEEDTPVIRAEKMEFRVRWRSDTGKCVDASPLLVIPALD
KSSATVYIGSHSHRMIAVDLYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVL
KSNSGEKYWMFSTENAVKSSATLDPTTGLLYIGSHDQHAYALDIYKKKCVWKLKCGGTVF
SSPCLSLIPSHLYFATLGGLLLAVNPATGDRVWKHSCGKPLFSSPRCCLQYIFIGCVDGN
LLCFTHFGEQVWQFSTNEPIFSSPCTSASEQEIFFGSHDCFIYCCSMKGHLRWKFETTAR
VYSTPFVFRNHNHNNEMLLAAASTDGKLWILESKSGQLQSVYELPGEVFSSPVVWESMLI
IGCRNNYVYCLDLLGDKGNEVQSLEYT
Download sequence
Identical sequences W5P092
ENSOARP00000003840 XP_004009889.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]