SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004028 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004028
Domain Number 1 Region: 931-1267
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.35e-117
Family Methionine synthase SAM-binding domain 0.0000000399
Further Details:      
 
Domain Number 2 Region: 22-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.88e-113
Family Homocysteine S-methyltransferase 0.00000964
Further Details:      
 
Domain Number 3 Region: 371-646
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.7e-86
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00055
Further Details:      
 
Domain Number 4 Region: 770-924
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.35e-40
Family Cobalamin (vitamin B12)-binding domain 0.00000293
Further Details:      
 
Domain Number 5 Region: 666-755
Classification Level Classification E-value
Superfamily Methionine synthase domain 4.97e-27
Family Methionine synthase domain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004028   Gene: ENSOARG00000003750   Transcript: ENSOART00000004099
Sequence length 1268
Comment pep:known_by_projection chromosome:Oar_v3.1:25:9465312:9573430:1 gene:ENSOARG00000003750 transcript:ENSOART00000004099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRELRKGEPKAGMEKTLQDEIEAILRERIMVLDGGMGTMIQRHKLSEEDFRGQEFKDHA
RPLKGNNDILSITQPNVIYQIHKDYLLAGADIIETNTFSSTAIAQADYGLEHLAYRMNMC
SAGVARKAAEEVTLQTGIKRYVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYKEQA
KGLLDGGVDILLIETIFDTANAKAALFAVQKLFEEEYVPRPVFISGTIVDKSGRTLSGQT
GEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDET
PQMMAMHVKDFAVDGLVNIVGGCCGTTPDHIREIAEAVKNCKPRVPPASVFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRRFAKLIMAGNYEEALSVAKMQVEMGAQVLDINMDDG
MLDGPSAMTRFCNFIASEPDIAKVVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGED
DFLEKARKIKKFGAAVVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPN
ILTIGTGMEEHNLYAVNFINATKVIKETLPGAKVSGGLSNLSFSFRGMEAIREAMHGVFL
YHAIKFGMDMGIVNAGSLPVYDDIHKELLQLCEDLIWNRDPEATEKLLRYAQTQGKGGKK
VIQTDEWRNGPVEERLEYALVKGIEKYIIEDTEEARLNQEQYPRPLNIIEGPLMNGMKIV
GDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETKVLTGKIEDEDPYQGTIVLAT
VKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKAVIDIIGLSGLITPSL
DEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLL
DENLKDEYFEEILEEYEDIRQDHYESLKERRYLTLRQARENGFHIDWLSEPPPVKPTFLG
TRVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFDDKTVGEEARKVYDDAQSML
QALISQKKLQARGVVGFWPAQSLQDDIHLYTEGAVPQASEPIATFYGLRQQAEKDSASSD
PYLCLSDFVAPLHSGIPDYLGLFAVACFGVEELSKAYEDECDDYSSIMVKALGDRLAEAF
AEELHERVRRELWGYCSGEQLAVADLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLADVEQ
RTGIRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYASRKNMSVSEVEKWLG
PILGYDTD
Download sequence
Identical sequences W5P0T0
ENSOARP00000004028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]