SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004037 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004037
Domain Number 1 Region: 1069-1114
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000804
Family Nuclear receptor coactivator interlocking domain 0.00057
Further Details:      
 
Domain Number 2 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000742
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00053
Further Details:      
 
Domain Number 3 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000445
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004037   Gene: ENSOARG00000003779   Transcript: ENSOART00000004108
Sequence length 1465
Comment pep:known_by_projection chromosome:Oar_v3.1:9:46650652:46929833:-1 gene:ENSOARG00000003779 transcript:ENSOART00000004108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTPDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSVLHVGDHTEFVKNLLPKSI
VNGGAWSGEPPRRNSHTFNCRMLVKPLPESEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPALPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHTQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHVLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHPAMCSGNPGQDMTLS
SNINFPMNGPKEQMGMPMGRFSGSGGMNHVSSMQATTPQGSNYALKMNSPSQSSPGLNPG
QPSSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPQLSKMGSLDSKDCFGLYGEPPEGPTGPA
ESSCHPGEPKDPSEAGLPAAGSNERPDGQSRLLDNKGQTKLLQLLTTKSDQIEPSPLPSS
LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQEAS
STAPGSEATIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTEKEEMSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAESSPVTLVGAQKTAMRIPQSTFNNPRPGQLGRLLPNQNFPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMLGSNAARPTMPSGEWAPQSPA
VRVTCAATSNAMSRPIQGGMIRNPTASIPMRPNSQPGQRQMLQPQVMNMGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQAPFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQGVDPEQFSSQDSSLMLEQKTPVFPQQYASQ
AQVAQGSYTPMQDPSFHTMGQRPSYATLRMQPRPGLRPTGLVQSQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHHQQQQVQ
QRTLMMRGQGLNMTPSVVAPSGVPATMSNPRLPQANAQQFPFPPNYGISQQPDPGFTGAA
APQSPLISPRLAHTQSPMLQQSQANPAYQASSDMNGWAQGSMGANSMFSQQSPPHFAQQA
NTSMYNNNMNINVSMATNTGGMSNMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRG
GGLFPSQLPGMDMIKQEGDASRKYC
Download sequence
Identical sequences W5P0T9
ENSOARP00000004037 XP_012039211.1.66739 XP_012039212.1.66739 XP_012039215.1.66739 XP_012039217.1.66739 XP_012039218.1.66739 XP_012039219.1.66739 XP_012039220.1.66739 XP_014953288.1.66739 XP_014953289.1.66739 XP_014953290.1.66739 XP_014953291.1.66739 XP_014953292.1.66739 XP_014953293.1.66739 XP_014953294.1.66739 XP_014953295.1.66739 XP_014953296.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]