SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004124 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000004124
Domain Number - Region: 38-100
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.046
Family Heme-binding PAS domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004124   Gene: ENSOARG00000003863   Transcript: ENSOART00000004197
Sequence length 111
Comment pep:novel chromosome:Oar_v3.1:4:46973875:46974874:-1 gene:ENSOARG00000003863 transcript:ENSOART00000004197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSD
NVDLEEAGKEGGKSREVMRLNKEGKWSYWHFSVSMDFDYNVNCSAGYRVTK
Download sequence
Identical sequences W5P125
ENSOARP00000004124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]