SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004316 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004316
Domain Number 1 Region: 390-662
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-86
Family Eukaryotic proteases 0.00000000178
Further Details:      
 
Domain Number 2 Region: 146-232
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-32
Family Kringle modules 0.00000651
Further Details:      
 
Domain Number 3 Region: 254-343
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-27
Family Kringle modules 0.00000688
Further Details:      
 
Domain Number 4 Region: 87-148
Classification Level Classification E-value
Superfamily GLA-domain 4.71e-18
Family GLA-domain 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004316   Gene: ENSOARG00000004038   Transcript: ENSOART00000004392
Sequence length 666
Comment pep:known chromosome:Oar_v3.1:15:74896927:74911872:1 gene:ENSOARG00000004038 transcript:ENSOART00000004392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGSPAACPYGPELPTSASRLISSRWFNINPVGSGPARREVPGVDTPWLPSCLALAAL
FSLAHSQHVFLAHQQASSLLQRARRANKGFLEELRKGNLERECLEEPCSREEAFEALESP
SATDVFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGNMSVTRSGIECQLWRSRYP
HKPEINFTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRREACSVPVCDMDDRVTVEVI
PRSGGSTTSQSPGLEMCVPDRGRGYQGRLAVTTRGSPCLAWSSEQAKALSKDQDFNPAVP
LVENFCRNPDGDEEGAWCYVAGQPGDFEYCDLDYCGEPVDGDLGDGLGEDPDAAIEGRTS
EDHFQPFFNEKTFGAGEADCGLRPLFEKKKLQDKTEAELFESYIEGRIVEGQDAEVGLAP
WQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEADLLVRIGKHSRTRYER
KVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIEFSEYIHPVCLPDKETAAKLLRVG
FKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKDSTRIRITENMFCAGYKPG
EGKRGDACEGDSGGPFVMKSPSNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKRWIQKV
IDRFGS
Download sequence
Identical sequences W5P1L7
ENSOARP00000004316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]