SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004335 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004335
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.53e-44
Family Carbonic anhydrase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004335   Gene: ENSOARG00000004061   Transcript: ENSOART00000004411
Sequence length 179
Comment pep:known_by_projection chromosome:Oar_v3.1:11:271266:298608:-1 gene:ENSOARG00000004061 transcript:ENSOART00000004411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFSSCQVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRIT
YKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETANWIIMNKPVYITRMQMHSLRL
LSQNQPSQIFLSMSDNFRPVQSLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Download sequence
Identical sequences W5P1N6
ENSOARP00000004335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]