SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004891 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004891
Domain Number 1 Region: 32-192
Classification Level Classification E-value
Superfamily UBC-like 1.93e-61
Family UBC-related 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004891   Gene: ENSOARG00000004571   Transcript: ENSOART00000004974
Sequence length 193
Comment pep:known_by_projection chromosome:Oar_v3.1:26:40578082:40655179:-1 gene:ENSOARG00000004571 transcript:ENSOART00000004974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDDDSRASTSSSSSSSSNQQTEKEANTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
Download sequence
Identical sequences L8IHR9 M3YL72 W5P391
ENSMPUP00000012079 ENSMPUP00000012079 ENSOARP00000004891 NP_001193145.1.59421 NP_001193145.1.76553 XP_004754419.1.14098 XP_005896785.1.15283 XP_005982299.1.78601 XP_006074180.1.26621 XP_006883405.1.29581 XP_010844736.1.44457 XP_012017869.1.54773 XP_014960143.1.66739 XP_017897329.1.57651 XP_019808948.1.53367 XP_020754060.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]