SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004895 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004895
Domain Number 1 Region: 324-380
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.15e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00013
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000034
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004895   Gene: ENSOARG00000004567   Transcript: ENSOART00000004978
Sequence length 380
Comment pep:novel chromosome:Oar_v3.1:3:75755491:75801497:-1 gene:ENSOARG00000004567 transcript:ENSOART00000004978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCVNGVAKLYRSVIEDVIEGVRDLFAEEGVEEQVLKDLKQLWETKVLQSKATEDFFRNS
VHSPLFTLQLPHSLHQTLQSSAAALVIPAGRTRPSFTAAELGTSNSSASFTFPGYPIHVP
VGVTQQTASAHLYKVSVPFMVTQTSERASILQPPVQQVFQLLGQPSIIQTSIPQLNPCFL
QATTEKSLRMETTLQQPIVLPSETVDRKHLENTGNEHKIISGALLNQLDSSSQMDLSIQV
TDGDIHEIIQIGGTGDTSSNDEIGNTRDVDENGLLGIIGAGDLKVPEEETGSVSNEDSSV
DSSDNEDPEIDLVEEDPLNSGDDVSEQDVPDLFDMDNVIVCQYDKIHRSKDKWKFYLKDG
VMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences W5P395
ENSOARP00000004895 XP_011970506.1.54773 XP_012027231.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]