SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004942 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004942
Domain Number 1 Region: 69-175
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.72e-35
Family P-domain of calnexin/calreticulin 0.00000853
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-18
Family Calnexin/calreticulin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004942   Gene: ENSOARG00000004620   Transcript: ENSOART00000005026
Sequence length 294
Comment pep:novel chromosome:Oar_v3.1:1:25743003:25758037:-1 gene:ENSOARG00000004620 transcript:ENSOART00000005026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPDICGFGNNKVQVILRYRGKYHENNKTIECRINKDTYLYTLIICPSGNNGKIDNKQVKA
GDLEDNWAFLPPRKIKDPYAQKPRKRDEQLQIEDPEDKKPEDWEDFEYIPDPDTKKPDDW
NEAMDGEWEGPLTPNLKYKGQWEPRIIDNSNYEGEWIHPEIDNPEYKPDPNICHYYISVL
GLDLWQMKSGSILDNFLLTNDEEFAEEVGNMTWGARKDVEKQWRELYEEMEKRKREEEAK
KKEEREYDIWGIEEEGSEDSAEEPGNDRQLKEDDDERAFLGENVEVHVDWKDEL
Download sequence
Identical sequences W5P3E2
ENSOARP00000004942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]