SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005266 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005266
Domain Number 1 Region: 1346-1486
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.3e-47
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000078
Further Details:      
 
Domain Number 2 Region: 241-331
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000084
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005266   Gene: ENSOARG00000004913   Transcript: ENSOART00000005353
Sequence length 1491
Comment pep:known_by_projection chromosome:Oar_v3.1:3:3394620:3438071:1 gene:ENSOARG00000004913 transcript:ENSOART00000005353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGCPAGEGWRRMEAAPDGAVDIVPLDRYDPARAKIAANLQWICAKAYGRDDIPEDL
RDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVASLQGHQSVIQALSRKGIY
VMESDDTPVTEPDLSHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWVNKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREQLCARQPPHFPL
LEDLMRDGSHGAALLAVVHYYCPGQLKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKC
FYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKSVSHPKSSRP
PVPISNATKRSFLGGPAAASPPPPPPLPRPTTCSSGSLSPCNPLFRGKGASAFSPSHPLL
PLRQKQQKAVQGEDPPDQRHRSSSLTRADSQPRGAAIAWTEKKNRPVSQPAPFALHHTAS
CDMDPSGGDSVSLARSISKDSLASSVVHLTPQNQPQPAALRTDGRSLLSNVDIEDEDEEL
LAIVRTDVARQGGDPGPMAGARSPQRLADAFESKPDSFFLEPLMPAVLRPAKEKQVVTKE
DECGEGRPRAFTSRRSGDGHQPLGRKKAPGSHVARDLNRTFTPISCSEMSAGFDAVPAEV
GPQVVGDTHGGPLAGSGFDPSSQGQSADGFFLHVGRADKDAEGRLYMSCARSPGALGPDT
WAVLRQDSDSDVADLDEAEQDFAGEEHPAARAGYGGEEESAKLQEDLKVREHDDKDDASG
RSSPCLSTVSQTSSASMASGSAKMTSFAERKLQRLNSCGEQCEXRKGVGALSARRRLQLG
KAAFLHVVKKGRADAAQQPLKAASLAGEHAQHNGDDFLGKEEGRGALLGSPDVDGEGLAL
VQPQKARDPAGLPELERGKALSAVLLEDAEGVDVGECDLSIEKLNETISTLQQAILRISQ
QQEQLLLKSPTPTALTGHRKPPRLGQGRNARSGRPAELKVPKERQQGSSRSKTPTPGLET
APPHLRSFPPRTPPEPGWDGLSEPGSEAAEKCAFDSYRLHDESNQRTLGRSSSRDANVLS
EQAGFREGLEGSAKEAGLSTVTAPGKENVPLDEPPRSKASLIEVDLSDLKAPDEDGETEG
RDSSVDLGSEGDQKPGVGFFFKDEQKADDELAKKRAAFLLKQQRKAEEARVRRQQLEAEV
ELKRDEARRKAEEDRIRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKARPRKPRPKS
VHREEPGSDLGPKSASPPDNLSRAQSGSSLSLASAATTEPESVHSGGTPSQRVESLEALP
VLSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKV
NEPHKNSILEASPFCDRAGEGHVSQREAPCSGRALYCYYPDTEEICKLTGTGPKSIAKKM
IDKLYKYSSDRKQFSLIPAKTMSVSVDALTIHNHLWQPKRPSAPKKTQTRK
Download sequence
Identical sequences W5P4B4
ENSOARP00000005266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]