SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005364 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005364
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000707
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000615
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000005364
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005364   Gene: ENSOARG00000005005   Transcript: ENSOART00000005451
Sequence length 798
Comment pep:known_by_projection chromosome:Oar_v3.1:21:43768738:43776312:1 gene:ENSOARG00000005005 transcript:ENSOART00000005451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGSTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLALPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLETRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYL
GFERSELLCKSWYGLLHPEDLGHASAQHYRLLAESGDIQAEMVVRLLAKPGGWAWIYCLL
YSEGPEGPITANNYPISDMEAWSLRQQLNSEETQAAYVLGTPTMLPSFPENILSQEQCSS
PNPLFTMGPPRSTSFPSAPELGAVSTSEELPRAPKDLGFSYLTFPSGPQPSLQADLSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHMPAPSSSLQEQLTPSTVTFSDQLTPNSATFPDP
LTSPLQGQLTETSARSYEDPCTSTFPDQLLPSTATFPEPLSSPAQEQLTSPSTSFQAHLN
SPRQTFPEQLSPNSSKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVP
LVPEGLLTPEASPVKQSFFHYSEKEQSEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLG
GLEPLDSNLSLSGAGPPVLSLELKPWKCQDLDFLTDPDLFLEETPVEDIFMDLSTPDPNG
EWESEDPEAAVPGGASSPCNNLSPEDRSFLEDLATYETAFETGVSAFPYDGFTDELHQLQ
SQVQDSFHKDGSGGEPTF
Download sequence
Identical sequences T2K1S4
NP_001274392.1.54773 NP_001274392.1.66739 ENSOARP00000005364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]