SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005550 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005550
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.53e-24
Family Ribosomal L11/L12e N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.45e-18
Family Ribosomal protein L11, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005550   Gene: ENSOARG00000005178   Transcript: ENSOART00000005637
Sequence length 192
Comment pep:known_by_projection chromosome:Oar_v3.1:21:43785795:43788896:-1 gene:ENSOARG00000005178 transcript:ENSOART00000005637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALRKPQAEGVIRAILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KAGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEI
ARVKARDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences W5P547
XP_004019743.1.66739 XP_005699979.1.57651 XP_011972716.1.54773 ENSOARP00000005550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]