SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005669 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005669
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-43
Family FKBP immunophilin/proline isomerase 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005669   Gene: ENSOARG00000005284   Transcript: ENSOART00000005757
Sequence length 141
Comment pep:novel chromosome:Oar_v3.1:21:41854567:41856080:1 gene:ENSOARG00000005284 transcript:ENSOART00000005757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMRLSWVLTVLSICVSALVTATGTEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLE
DGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKI
PGGATLVFEVELLKIERRSEL
Download sequence
Identical sequences W5P5G6
ENSOARP00000005669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]