SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005702 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000005702
Domain Number - Region: 76-191
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0602
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005702   Gene: ENSOARG00000005310   Transcript: ENSOART00000005790
Sequence length 248
Comment pep:known_by_projection chromosome:Oar_v3.1:21:11879925:11902222:1 gene:ENSOARG00000005310 transcript:ENSOART00000005790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRWVRPLLCSEVLSPCGRFSPTLRRDFITTTTKEGYDMRRVDITPLEQRKLTFDTHAL
VLDLEAHGFDKAQAETIVSALTTLSNVSLDTIYKEMVTQAQQEITVQQLMAHLDSIRKDM
VILEKSEFANLRAENQKMKIELEQVKQQLINETSRIRADNKLDINLERSRVTDMFTDQEK
KLMEATTEFTRNDTKTRGIISETGNKIDTEIASLKTLMESNKLETIRYLAASVFTCLAIA
LGVYRLWK
Download sequence
Identical sequences W5P5J9
ENSOARP00000005702 XP_004019464.1.66739 XP_012008706.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]