SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006020 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000006020
Domain Number - Region: 274-306
Classification Level Classification E-value
Superfamily Kringle-like 0.0864
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006020   Gene: ENSOARG00000005610   Transcript: ENSOART00000006111
Sequence length 463
Comment pep:known_by_projection chromosome:Oar_v3.1:2:143438961:143502283:1 gene:ENSOARG00000005610 transcript:ENSOART00000006111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYPGRRPVIPPQSHQDDRETLVSEHKHKGKTCRQSAAVFNVVNSIIGSGIIGLPYSMKQ
AGFPLGILLLFWVSYVTDFSLILLIKGAALSGTDTYQSLVNRTFGFPGYLLLSVLQFLYP
FIAMISYNIITGDTLSKVLQRIPGVDPENLLIGRHFIIVLSTVVFTLPLSLYRDIAKLGK
ISLISTVLTTLILGIVVARVVSLGPHIPKTEDAWIFAKPNAIQAVGVMSFAFICHHNCFL
VYSSLEEPTVAKWSHIIHVSTLISVFISILFATCGYLTFTGYTQGDLFENYCRNDDLVTF
GRFCYGVTVILTYPIECFVTREVIANVFFGGNLSSGFHIIITVVIITVATLVSLLVDCLG
IVLELNGVLCAAPLIFIVPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMAVGFVMAVTS
PQDCSHGQEMFYCSLDNFSLTNISISHFQLTTQLSILNVSIFQ
Download sequence
Identical sequences W5P6G6
ENSOARP00000006020 XP_004004697.1.66739 XP_012018009.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]