SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006039 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006039
Domain Number 1 Region: 353-461,583-699
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-55
Family Phosphate binding protein-like 0.00000000849
Further Details:      
 
Domain Number 2 Region: 42-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-19
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006039   Gene: ENSOARG00000005625   Transcript: ENSOART00000006130
Sequence length 1364
Comment pep:known_by_projection chromosome:Oar_v3.1:24:8485907:8665389:-1 gene:ENSOARG00000005625 transcript:ENSOART00000006130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRHVISFPSLLGRSYEDRWSYVSCLLPHLLFCFLFTPWQDPTSTFFQFGASIQQQATVM
LKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQ
LKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLIS
VSYDDWDYSLEARVRDGLGILTTAASSMLDKFSYIPEAKASCYGQTEKPEAPMHTLHQFM
VNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSD
CEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKG
FCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYHRAVMAVGSLTINEER
SEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEY
FSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFA
VIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNY
PYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFAT
TGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMA
GVFYMLLVAMGLALLVFAWLFYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKK
KSPDFNLTGSQSNMLKLLRSAKNISNLSNMNSSRMDSPKRAADFIQRGSLIMDMVPDKGN
LVYSDNRSFQGKDSIFGDNMSELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAV
STESKGNSRPRQLWKKSMESLRQDSLTQNPISQRDEGPVENRTHSLKSPRYLPEEVAHSD
VSETSSRAACHREPDNNKNHKAKDNFKRTMASKYPKDCSEAERSYLKTKASSPRDKIYTI
DGEKEPSFHLDPPSFAESMALPENVDFSDTYQERSESFRKGDSTLPLNRNAVHDEDVLPN
NEPYKLYSKHFSLKDKSSPHSEGSDRYRQNSTHCRSCLSNLPTYAGHFTVRSPFKCDACL
RMGNLYDIDEDQMLQETGNPAAQEEVYQQDWAPNSALQLQKNKLRISRQHSYDNILDKPR
EVDPSRPSRSISLKDRERLLEGNLYGSLFSVPSSKLAGNKGSLFPQGLEVGKRSKSLLPD
HTSENPFLHSYGDDQRLVIGRCPSDPYKHSLPSQAANDGYLRSSLRSTASYCSRDSRGHS
DVYISEHVMPYAANKNNMYSAPRVLNSCSNRRVYKKMPSIESDV
Download sequence
Identical sequences W5P6I5
ENSOARP00000006039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]