SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006129 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006129
Domain Number 1 Region: 114-292
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.49e-28
Family NadC C-terminal domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 10-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.1e-24
Family NadC N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006129   Gene: ENSOARG00000005716   Transcript: ENSOART00000006223
Sequence length 306
Comment pep:novel chromosome:Oar_v3.1:24:26506332:26507999:-1 gene:ENSOARG00000005716 transcript:ENSOART00000006223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLPGLACLLPPATLAALADSWLREDCPGLNYVALVSGTAPSQAVLWAKSPGVLAGRPFF
DAIFAQVNCQVSWFLPEGSKLVPVAKVAEVRGPAHCLLLGERVALNTLARCSGVASVAAA
AVETARGTGWAGHVAGTRKTTPGFRLGGKNGLLVGGLRGGGAPPHRYDLGGLVMVKDNHV
MAAGGVKKLVGMMLQGKGRTIGSQCWCANVQEAISTPLNPKLIIYLEPFAWQFQLTCPGA
AALKAQFPSVSVEASGGVTLDNLPQFCGPHVDVISLGMLTQAAPALDFSLKLFAEGATPV
PHARRS
Download sequence
Identical sequences W5P6S5
ENSOARP00000006129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]