SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006140 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006140
Domain Number 1 Region: 260-345
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.31e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000443
Further Details:      
 
Domain Number 2 Region: 94-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 10-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000135
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006140   Gene: ENSOARG00000005722   Transcript: ENSOART00000006234
Sequence length 869
Comment pep:known chromosome:Oar_v3.1:3:77880264:77921519:-1 gene:ENSOARG00000005722 transcript:ENSOART00000006234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLVSQLRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAI
SFLRTHKLLSSVCSENESEADADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGL
TQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGR
TVNLKSATWKVLHCTGQVKVYSNCPPPKIQFCNTHSPNAENLPLLCPLQHQTHLRIPVQS
SVFLERISLNLLFFFSQFRITELVGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQ
VVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTES
PFKPHLLTMNSIFDNSGKVAVSEKSNFLFTKLKEEPEELAQLAPTAGDTIISLDFGTPNF
EESSAYGKGILPPSQQWTGEVKSHGTHSEAGSLPAFTVPQAAALGNSTPSASSSSSCSTP
SSPGDYYTSLDDNLKIEAIEKLFAMDTEAKDQCGTQTDFNELDLETLAPYIPMDGEDFQL
SPICPEESLLPETPQSTPQHCFSTMSNIFQPLAPMASHSTFLLDKYQQQLESKKTEPEQR
RVSFTFFDGGSKVSLLQRCGQTYTPLSSMGGISSTQWPPDPPLQLGPMKWPGEDQHAEAL
GTVPLGAPIATPHLATFKKRSAKGFGPQGPDVMSPAMIALSNKLKLKRQLEYEEQAFQDL
SGGDPPGSSTSHLMWKRMKSLRGGGTCSLMPDKLPNADVPNDEFIQNPVRGRSQPLRHLP
PPQPPSATNPGEPTKSGFPPQCYAPQYQDYSLPAAHKMSGMASRLLGPSFEPYLLPELTR
YDCEVNVPVPGTSTLLQGGDLLRALDQAT
Download sequence
Identical sequences W5P6T6
ENSOARP00000006140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]