SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006395 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006395
Domain Number 1 Region: 219-384
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000188
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006395   Gene: ENSOARG00000005964   Transcript: ENSOART00000006492
Sequence length 593
Comment pep:novel chromosome:Oar_v3.1:21:43856804:43872654:1 gene:ENSOARG00000005964 transcript:ENSOART00000006492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATSSSDSDSGKGESSEANSKWLDSLSDSMANIHTFSACLALADFHGDGEYKLAMGDLG
PDGRQPRLKVLKGHTLVSQKPLPDLPAAAVTFLVGSHEPRTPALAIASGPCVYVYKNLKP
YFKFSLPLLPTNPLEQDLWNQAKEDQIDPLTLKEMLEGIREKAEVPLSVQSLRFLPLELS
EMEAFVNQHKSKSIRRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILA
KMSLPSVPVFLEVSGQFDVEFRLAAACRNGSIYILRRDSKCPKYCIELSAQPVGLVRVHK
VLVVGSNQDSLHGFTYKGKRLWTVQMPAAILAMNRLEQRSRGLQAVMAALANGEVRIYHD
KVLLNVIRTPEAVISLCFGRYGREDNTLIMTTLGGGLIIKILKRTAVFAEGGGEAGSAPN
QPSKGNVPRKTRLYVDQTLREREAGTAMHRTFQADLYLLRLRAARAYVQALESSLSPVSL
MAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPILGLVVCFLYNEVLYALPRAFFKVPLL
VPGLNYPLETFVKSLSDKGISDIIKVLVLREGQSTPLLSAHINMPMSEGLAAD
Download sequence
Identical sequences W5P7J1
ENSOARP00000006395 XP_014958681.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]