SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006835 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006835
Domain Number 1 Region: 436-933
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-125
Family ALDH-like 0.00000000986
Further Details:      
 
Domain Number 2 Region: 23-224
Classification Level Classification E-value
Superfamily Formyltransferase 5.36e-37
Family Formyltransferase 0.0000000094
Further Details:      
 
Domain Number 3 Region: 228-330
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 5.97e-26
Family Post formyltransferase domain 0.00000175
Further Details:      
 
Domain Number 4 Region: 348-440
Classification Level Classification E-value
Superfamily ACP-like 0.000000446
Family Acyl-carrier protein (ACP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006835   Gene: ENSOARG00000006377   Transcript: ENSOART00000006939
Sequence length 934
Comment pep:known_by_projection chromosome:Oar_v3.1:19:59698219:59726176:-1 gene:ENSOARG00000006377 transcript:ENSOART00000006939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WASAPHGTLRASCPGPPARPAAMKIAVIGQSLFGQEVYCRLREEGHEVVGVFTVPDKDGK
ADPLGLQAEQDGVPVFKFTRWRAKGRALPDVVAQYQALGAELNVLPFCSQFIPMEVISAP
RHGSIIYLSMVFPSGLRCHSSIPRTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPD
DTVSSLYNRFLFPEGVKGMVQAVKLIAEGKAPRLPQPEDGATYEGIQRKETARIDWDQPA
EAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTAGLEPEGEDLPIPGAHRPGVVTKAGL
ILFGNDGRMLLVKNIQLEDGKMIPAARFFRRAESSTLELTEEELGTAEAVRDAWKRILPS
VPEVDESTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRRLRG
DDKEAECAIAYVEKAVNKLTLRMPHQLFIGGAFVDAEGGKTYETISPADGSSRGGQVHTH
THTHTPTHVLRWTHSYTRTPTGTGHRRRALRGFEESNRLAELMEQHQEELATIEALDAGA
VYTLALKTHVGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLSMTRREPVGVCGIIIPW
NYPLMMLSWKTAACLAAGNTVVVKPAQVAPGEDGRVWPWVAGGGWPGSRAALTPLPRPSC
TGSLVGQRLSDHPDVRKIGFTPCPSPSLPIPFSCALSNVKKVSLELGGKSPLLIFADCDL
GKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDQFVQRVVEEVGKMKIGNPLDRDTDHGP
QNHLAHLKKLLEYCRRGVEEGATLVCGGKQVPRPGFFFEPTVFTDVQDHMFIAREESFGP
VMIISRFADGDVDAVLTRANATEFGLASGVFTRDINKALYVSDKLEAGTVFVNTYNKTDV
AAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Download sequence
Identical sequences W5P8S8
ENSOARP00000006835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]