SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007101 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007101
Domain Number 1 Region: 66-155
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007101   Gene: ENSOARG00000006629   Transcript: ENSOART00000007208
Sequence length 627
Comment pep:known_by_projection chromosome:Oar_v3.1:18:43064631:43193191:1 gene:ENSOARG00000006629 transcript:ENSOART00000007208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEV
RIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLL
NKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKDTPMDIA
QLPHLPEKTSESSETSDSESDSKDTSEDNENSKSDEKGNQSENSEDPEPDRKKSGNTCDN
DMHCNDDGHSSSNPDSRDSDDSFEHSDFENPKAAEDGGGGGFGALGRMQIKVERGYVESE
SDLRLQDCESLSSDSGTAMAPATAPATRTAATATTASSIRTLRTPRRPRTASGAASARRR
RLPSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISR
NESPYSMTKPPSSEHFPSPLGVGAARLGAVVCAARRVAPDTPREGGGGHRNGGGGPGAAN
SLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQG
NLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGAAGLTQMPAGNVFTTA
EGLFSTLPFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences W5P9J3
ENSOARP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]