SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007339 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007339
Domain Number 1 Region: 104-199
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.57e-22
Family Middle domain of MutM-like DNA repair proteins 0.018
Further Details:      
 
Domain Number 2 Region: 11-61
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000536
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 267-294
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000353
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007339   Gene: ENSOARG00000006852   Transcript: ENSOART00000007450
Sequence length 554
Comment pep:known_by_projection chromosome:Oar_v3.1:26:7305963:7350958:1 gene:ENSOARG00000006852 transcript:ENSOART00000007450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAALNNNKNSSQDFLRLFNGHVYSGVETLGKELFMYFGPKALRIHFGMKGSLIINPVESK
NKNGVSPDFEVQLTKDLICFFDSSVEIRNATESQQRIRVMEELDVCSPRFSFSRAESEVK
KQKGRMLCDVLMDQKVLPGVGNIIKNEALFDSGLHPSVKVCQLTDEQIHHLVKMIRDFSI
LFYRCCKVGSALSQHYKVYKRPNCGQCCCKITVCRLGENNRMTYFCPHCQKENPQHVDIC
MLPVRNTTVSWPSSREGHLIDCVAQKSEEQWTCEVCTLINKPSSKTCDACLTSRPADSVF
RNEGNPTVFNNLVKYPCNSFGKPKAKVKINRKTAFGTTTLVLTDFSNKYSALEREESHNH
IPDGEFPSPPPNMCGSDTLTTSKERTNYRSQPSDKINTSPIVYSQYKLFSPAHKKLKTTH
YSSPDLKSCNPGFSNSELQSNMTDGPRLLNAGSPRCSKHGRPCALRVVRKSGENKGRHFY
ACPLPREAQCGFFEWADLSFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPLGKEKQCNFFQ
WAQNGPGINIIPGC
Download sequence
Identical sequences W5PA80
ENSOARP00000007339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]