SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007435 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007435
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.73e-84
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000674
Further Details:      
 
Domain Number 2 Region: 198-231
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000565
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007435   Gene: ENSOARG00000006942   Transcript: ENSOART00000007546
Sequence length 232
Comment pep:known_by_projection chromosome:Oar_v3.1:4:116893522:116902118:-1 gene:ENSOARG00000006942 transcript:ENSOART00000007546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLARCLLVLLVSSLLMCSGLACGPGRGFGKRRNPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNH
VHVSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAAGDEGR
Download sequence
Identical sequences W5PAH5
ENSOARP00000007435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]