SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007981 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007981
Domain Number 1 Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000719
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007981   Gene: ENSOARG00000007437   Transcript: ENSOART00000008098
Sequence length 246
Comment pep:known_by_projection chromosome:Oar_v3.1:17:52225032:52254995:1 gene:ENSOARG00000007437 transcript:ENSOART00000008098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAASEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDSRKARLTQKYQELQVLFEAYQIKKTKLDKQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQAPAPAPLPP
RVPELAPAAPLPYPAPEASGPPSMVPRRMPPPPPPXSLLRPPPPPPARPRSPPPRLPPHQ
PGFILQ
Download sequence
Identical sequences W5PC20
ENSOARP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]