SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008424 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008424
Domain Number 1 Region: 434-725
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-68
Family Protein kinases, catalytic subunit 0.000000751
Further Details:      
 
Domain Number 2 Region: 270-392
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-35
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 58-146
Classification Level Classification E-value
Superfamily Immunoglobulin 9e-22
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000008424
Domain Number - Region: 164-251
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0196
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008424   Gene: ENSOARG00000007850   Transcript: ENSOART00000008546
Sequence length 908
Comment pep:known_by_projection chromosome:Oar_v3.1:2:26611152:26666181:-1 gene:ENSOARG00000007850 transcript:ENSOART00000008546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNGIKALKGNLINVCAVLFCPGQVEVPDSNDPLGQLDGHDSPVPTLKGYFLNFLEPVNN
ITIVQGQTAILHCKVAGNPPPSVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDT
GYYQCVATNGVKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRT
IYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRE
LCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERL
GRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHLTSTDFPELGGGHAYCRNPGG
QMEGPWCFTQNKNVRMELCDVPSCSPQDSSRMGILYILVPSIAIPLVIACLFFLVCMCRN
KQKASASTPQRRQLMASPSQDVEMPLINQHKQAKLKEISLSTVRFMEELGEGRFGKVYKG
HLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEALLRARLQHPNIVCLLGVVTKDQPLS
MIFSYCPHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEYLSSHH
VVHKDLATRNVLVYDKLTVKISDLGLFREVYSADYYKLTGSALLPIRWMSPEAIMYGKFS
VDSDIWSYGVVLWEVFSYGLQPYCGHSNQDVVEMVRSRQGLPCPDDECWHEFPSRRPRFK
DIHSRLRAWGNLSTYNSSAQTSGASNATQTSSLSTSPVSNVSNARYGGPKQKAQPFPQPQ
FIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPAQMVPKPG
SHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDAQNVPEDVAQSPVQEAEEEALQMG
EAEVQLEA
Download sequence
Identical sequences W5PDB2
ENSOARP00000008424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]