SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008460 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008460
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008460   Gene: ENSOARG00000007878   Transcript: ENSOART00000008583
Sequence length 941
Comment pep:known_by_projection chromosome:Oar_v3.1:8:12446609:12579375:-1 gene:ENSOARG00000007878 transcript:ENSOART00000008583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAMAARTHSGKEDASKVILEQDKCNIAVE
EEYITDEKKKRKSNQLKEIRRTELKRYYSIDDNPNKTHDKKEKKMVVQKPHGTMEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDASFPSSTLRFSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSLNKEKRQQNGERTVTSDSTSAGPSEKSTEYIET
KPSDSSVSVKVKKLESSAEATQQSTPVANVSKEPSDTQAAFESIAKENSLLGEDDDFVDL
EELSSQTKGVTDKRDTAKECLSLDPEERRKTKAQLISPTTEIQSALNFSGTECDAELKGA
LDLETCEKQDIMPEVDKQSGSPESQVENTLDIHEDLDKVKLIEYYLTKNKEGSQLPDNMQ
KAELSDGKSTEPVGIDITLSSSLPQTGDPPIEGKEEPDKPWARERAALPLQLSSSAEEGM
NKEYPDSSLESTLDNSCQGAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCI
KVGKPMRKSFATHTTAVVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKE
QGFVVVEKEELTMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEAALPTLQPHSA
LLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSAALDSPVLLVIKDMDNQ
IFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGRF
GLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences W5PDE7
XP_012037865.1.66739 XP_014961527.1.54773 ENSOARP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]