SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008487 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008487
Domain Number 1 Region: 516-699
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.67e-53
Family Hemopexin-like domain 0.0000000751
Further Details:      
 
Domain Number 2 Region: 90-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.01e-32
Family Matrix metalloproteases, catalytic domain 0.000000845
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-21
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 2.8e-20
Family Fibronectin type II module 0.00018
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 2.83e-19
Family MMP N-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008487   Gene: ENSOARG00000007908   Transcript: ENSOART00000008611
Sequence length 700
Comment pep:known chromosome:Oar_v3.1:13:74286196:74293399:1 gene:ENSOARG00000007908 transcript:ENSOART00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRQPLVLALLVLACCSAAPSPRQPTVVVFPGERRTSLTNRQLAEEYLYRYGYTPAAEL
SEDGQSLRRALLSFQRRLSLPETGELDSTTLDAMRAPRCGVPDLGGFQTFEGELKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGSGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRS
YSSCTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFEGRTYS
ACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSA
CTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPATTTAEPQPTAPPTVCVTGPPTARPS
EGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIGNRLHFFKAGK
YWKLSGGGGRRVQGPFLVKSTWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASVLGP
RRVARVTGALPRPGGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFPGVPISTHDIFQY
QEKAYFCQDHFFWRVSSRNEVNQVDYVGYVTFDLLKCPED
Download sequence
Identical sequences W5PDH4
ENSOARP00000008487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]