SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008564 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008564
Domain Number 1 Region: 157-261
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 303-408
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 3 Region: 10-115
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 538-642
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 5 Region: 652-766
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-34
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000008564
Domain Number - Region: 122-144
Classification Level Classification E-value
Superfamily dUTPase-like 0.0118
Family dUTPase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008564   Gene: ENSOARG00000007979   Transcript: ENSOART00000008689
Sequence length 1108
Comment pep:novel chromosome:Oar_v3.1:22:41355527:41392391:1 gene:ENSOARG00000007979 transcript:ENSOART00000008689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAHSGCGLPWSLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAIS
APGDARFGQGSGPIVLDDVGCSGHETYLWSCSHNPWNTHNCGHSEDASVICSAAQIASPS
PGWSSLTSKGITVHPGVIDSNWWTPKTTTTQRTESGLSLRLVNGGDRCQGRVEVLYRGSW
GTVCDDSWDTNDANVVCRQLGCGWAISAPGSARFGQGSGPIVLDNVGCSGHETYLWSCSH
NPWNTHNCGHSEDASVICSAAQTQSTVVPDWWNPTTGYATQALSTAVPDWWNPTTDYGTE
SGLSLRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDVNDANVVCRQLGCGWAISAPGSARF
GQGSGPIVLDNVGCSGHETYLWSCSHNPWNTHNCGHSEDASVICSAPQTQSTVAPDWWYP
TTGPQTWVQFLPLGSGSDVTTGSNAHLDPEVPILYVPTHFLTSAWFVSGFKLKKKDSKNL
QSESRVHSPGFHHTAIGDNSTVQVFITQSSEINPQCLFLQGKQEGDFSCLLPVSESGLSL
RLVNGGDRCQGRVEVLYRGSWGTVCDDYWDVNDANVVCRQLGCGWAISAPGSAWFGQGSG
PIVLDDVGCSGYETYLWSCSHNPWNTHNCGHHEDASVICSDWLSSTTTTTPTANYSCGGF
LTQSSGNVSSPFYPRNYPNNAKCVWDIEVQNNYRVTVTFRDVQLEGGCNYDYIEVYDGPH
HSSQLLARVCDGARDSFTSSSNFISIRFISDTSITKRGFSAEYFSIPSNGNTKLLCLQNH
MQANVKTSYLQSLGYSARDLAIPGSDTSYQCQPQITSSQVTFMIPYSGCGTTQQVDNDTI
TYSNFLKATASSGIINRKRDLQIHVSCKMLQNTWVNTIYVTNDTIEVENIQYGNFDVNIS
FYTSSSFLYPVTSSPYYVDLNQNLYLQAEILHSRASLALFVDTCVASPNPNDFTSLTYDL
IRSGCVKDETYRPYHQPSSNIVRFKFSSFHFLNRFPSVYLKCKMVVCRAYDPFSRCNRGC
IVRGKRDVSSYQEKVDVVLGPIQLQASPQKRKLDRQVVDTEEETSTHGSYHSATIFAGVL
VVMVVAVAAFALARRVRAARAQPPSTKM
Download sequence
Identical sequences W5PDQ0
ENSOARP00000008564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]