SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009028 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009028
Domain Number 1 Region: 387-526
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000177
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000009028
Domain Number - Region: 118-267
Classification Level Classification E-value
Superfamily TPR-like 0.00142
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number - Region: 21-90
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0286
Family Extradiol dioxygenases 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009028   Gene: ENSOARG00000008414   Transcript: ENSOART00000009159
Sequence length 622
Comment pep:known_by_projection chromosome:Oar_v3.1:5:3693520:3726375:-1 gene:ENSOARG00000008414 transcript:ENSOART00000009159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVVQAKMAAQAAAAAQAAAAQAAQAEAAESWYLALLGFASHRYRASSHVIIRLRVHAGPM
VTLAFPENPEVTPEASEGVSLNSVAFCTEGNPHFLVMLEKVWLISQQIPQFEDVKFEAAS
LLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVG
AEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVF
FLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVL
VYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTG
HKATALQEISQVCQLCQQSPRLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNH
QELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSSHCLRAAAFYVRGLFSFF
QGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASK
IPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWT
DGPPPVQFQAQNGPNTSLASLL
Download sequence
Identical sequences W5PF13
ENSOARP00000009028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]