SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009080 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009080
Domain Number 1 Region: 357-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-133
Family Transferrin 0.0000000000928
Further Details:      
 
Domain Number 2 Region: 22-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.06e-129
Family Transferrin 0.000000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009080   Gene: ENSOARG00000008456   Transcript: ENSOART00000009212
Sequence length 704
Comment pep:known chromosome:Oar_v3.1:1:253633735:253672933:-1 gene:ENSOARG00000008456 transcript:ENSOART00000009212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAVRALLTCAVLGLCLADPEKTVRWCTISTHEANKCASFRENMLRIFENGPFVSCVKK
TSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVK
KGTDFNLNELKGKKSCHTGLGRSAGWNIPMGRLYKELPDPQESIQRAAASFFSASCVPCA
DQSSFPKLCQLCAGKGTDKCACSNHEPYFGYAGAFKCLAEGSGDVAFVKHSTVFDNLPNP
DDRKDYELLCGDNTRKSVDDYHGCHLAKVPSHAVVARTVGGKEDVIWELLNHAQEHFGKD
KPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDTSTD
ECKVKWCAIGHQERTKCDQWSGFSGGAIECETAENTEECIAKIVKGEADAMSLDGGYLYI
AGKCGLVPVLAENYETEGTDCKDTPEKGYLAVAVVKASDADLNWNNLKGKKSCHTAVDRT
AGWNIPMGLLYSKINNCKFDEYFSAGCAPGSQRNSSLCALCIGSEKGSGKECVPNSNERY
YGYTGAFRCLVEKGDVAFVKDQTVKQNTDGNNGEEWAKDLKKGDFELLCKDGTRKAVGDA
ENCYLARAPNHAVVSRKDKATCVERILKEQQANFGKAVTDCTSNFCLFQSTSKDLLFRDD
TKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
Download sequence
Identical sequences W5PF65
ENSOARP00000009080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]