SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009088 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009088
Domain Number 1 Region: 177-434
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-79
Family Eukaryotic proteases 0.00000000423
Further Details:      
 
Domain Number 2 Region: 51-163
Classification Level Classification E-value
Superfamily Kringle-like 1.64e-32
Family Kringle modules 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009088   Gene: ENSOARG00000008473   Transcript: ENSOART00000009220
Sequence length 442
Comment pep:known chromosome:Oar_v3.1:25:29676048:29685840:1 gene:ENSOARG00000008473 transcript:ENSOART00000009220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLACLLVCALVVSDSDGSNEVHKESGVSDCGCLNGGKCVSYKYFSNIQRCSCPKKFQ
GEYCEIDTSKTCYQGNGHSYRGKANTDLRGRPCLAWDSATVLLKMYHAHRSDAIQLGLGK
HNYCRNPDNQRRPWCYVQVGLKQFVQECMVQDCSAGECHWPVYDGKSPSSPKEKVEFQCG
QKALRPRFKIVGGEFTTIESQPWFAAIYRRHRGGSVTYLCGGSLISPCWVVSATHCFTNH
PKKEDYIVYLGRSKLNSDTLGEMKFEVEKLILHEDYSADSLAHHNDIALLKIRTSRGQCA
QPSRSIQTICLPPLYGDARFGTRCEITGFGKENPSDYLYPEQLKMTFVNLVSHEECQQPH
YYGTEVTDKMLCAADPQWETDSCQGDSGGPLVCTIQGRLTLTGIVSWGRECAMKDKPGVY
TRVSKFLPWIYTHTRGEIDLGL
Download sequence
Identical sequences W5PF73
ENSOARP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]