SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009144 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009144
Domain Number 1 Region: 357-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.66e-137
Family Transferrin 0.000000000611
Further Details:      
 
Domain Number 2 Region: 23-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.72e-121
Family Transferrin 0.000000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009144   Gene: ENSOARG00000008517   Transcript: ENSOART00000009277
Sequence length 705
Comment pep:novel chromosome:Oar_v3.1:1:253699876:253733748:-1 gene:ENSOARG00000008517 transcript:ENSOART00000009277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLVLWLPYTSGLSSLGLCLAVPEKTVRWCTVSDLEASKCYSFHDNMKKVLSVDGPHVAC
VKRTSYRDCIRAIAAHEADAVMVDGGLVYEAGLKPYNLKPVVAEFYGSKDDPQTQHYVVA
VVKKGSDFQLNQLQGKKSCHTGLGWSAGWNIPMRILLPSNWSQEAAAKFFTSSCVPCADQ
SNFPTLCQLCVGKGMDKCACSHHEPYFGYSGAFKCLQDDVGDVSFVRHLTVFENLANPAD
RDQYELLCRENTRRPVDEYKECHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKS
AEFQLFYSPHGKDLLFTDAAIGFLRVPTKMDAKLYLGYEYFSVIQHLGRAVPEAEGPQRV
MWCTVGHDEHVKCNQWSALSGGILTCTGEESTEDCIAAVAKGEADAMSLDGGFIYTAGKC
GLVPVLAENYLSQDGKEQLGSKCVNTPMKGYYVVAVVKKSDADLTWNSLRGKKSCHTAVG
TSAGWNIPMGFVYNQTGSCKFDEFFSQSCAPGSDPESSLCALCRGSFKPAHMCAPNSHEQ
YYGSSGALRCLVEKGDVAFVKHPTVLQNTDGKNPEAWAKNLKPEDFQLLCLDGSRKPVTE
AQSCHLAVVPSHAVVSRKDKADFVRRMLFNQQELFGRNGFEYMMFQLFKSPAKDLLFSDD
TECLANLQDRTTYQKYLGPEYLQAIANVRHCLPSELLDACTFHGN
Download sequence
Identical sequences W5PFC9
ENSOARP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]