SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009181 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009181
Domain Number 1 Region: 95-152
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-17
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 64-106
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000002
Family Fibronectin type II module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009181   Gene: ENSOARG00000008559   Transcript: ENSOART00000009314
Sequence length 154
Comment pep:known chromosome:Oar_v3.1:14:50624978:50632184:1 gene:ENSOARG00000008559 transcript:ENSOART00000009314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLGLFLIWAGVPVFLQLHPVNGVLDEPLPDVYDLPETPTTTPSYTIAGAQVEKPHED
DSPPCAFPFTYKRRIYYKCTSVNSEREWCSLDEDYVGRWKICSKRDRPKCHFPFIYRDKR
YFRCTTEGSAFGLAWCSLTEYFEREYAWQYCDRY
Download sequence
Identical sequences W5PFH1
ENSOARP00000009181 ENSOARP00000009186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]