SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009269 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009269
Domain Number 1 Region: 96-173
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000144
Family Heme-binding PAS domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000009269
Domain Number - Region: 484-570
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0222
Family Adhesin YadA, collagen-binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009269   Gene: ENSOARG00000008639   Transcript: ENSOART00000009405
Sequence length 636
Comment pep:known_by_projection chromosome:Oar_v3.1:X:79350423:79414683:-1 gene:ENSOARG00000008639 transcript:ENSOART00000009405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDDGRKRRRYRDLSEDEKKMHINSVLRGLHDFLQRKGSPVKKNRVEKSQSISALSQKT
ETLNWTPSFQNYEDFIQKTLQDMRCLWFLLPKELSLDGFMIIVSTDGIIISVARRITSLL
GHLPNDIVGKSFLSLLPDDEKSEIFSKMAFRIPVSCSVGKHIEFCCHFKRGDAESNNTST
YEYVKVILTLKDVSNEHPVLSHSFFSRPDCGSSTINLPLDDAFYLMGTICVLRAQTLQGF
FRTNGPRPLVPNSDEDRLSEDHRSVQEERRCFGMDSSEIEIVDAEEPANTIEIELSESSD
SMDSFNENFVMSDDFNTVSLPSIPASPEMYSRQSFESEPEMGHVTYVYELRHVHKVDDMD
EREESDEDVQENQEDQEDEEDQKEVQEDQKEVQEDQEEVQEGQEEVQEGQQEVQEGQEEV
QKGQQEVQENQEEVQEGQQEIQEGQQKVQEGQQEVQEGQQEVQEDQEEVQEGQQEVQEGQ
QEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQ
EGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQQEVQEGQE
EVQEDQKDQEDQEDQKEQEYQVGRVGQVDQKGPGDQ
Download sequence
Identical sequences W5PFQ4
ENSOARP00000009269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]