SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009424 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009424
Domain Number 1 Region: 206-335
Classification Level Classification E-value
Superfamily TPR-like 1.9e-27
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Domain Number 2 Region: 91-176
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000275
Family FKBP immunophilin/proline isomerase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009424   Gene: ENSOARG00000008782   Transcript: ENSOART00000009561
Sequence length 345
Comment pep:known_by_projection chromosome:Oar_v3.1:20:26381712:26382749:1 gene:ENSOARG00000008782 transcript:ENSOART00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPPVNSMGEKDSCQPQQQGEKNFELPTQIRQHPQESPTEILELRVSPDPASQILENPQ
ETEKLAAELEKDSAKSRGSASAMSEPLQASDLWYCPDGSFVKKIVVRGHGLDKPKLGSRC
RVQASGFPLGSGLPEGWTELTVGLGPWREETWGELIEKCLESMCQGEEAELQLPGRSGLP
VRLTLASFTQGRDSWELEDTEKEALAREERARGTELFRAGNPEGAARCYARALRLLLTLP
PPGPPERTVLHANLAACQLLLGQPHLAAQSCDRVLEREPGHIKALYRRGVAQAALGNLEK
AMTDLKKVLAVDPKNRAAQEELGKVIIQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences W5PG59
ENSOARP00000009424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]